Loading...
Statistics
Advertisement

cnfocus
www.cnfocus.net/

Cnfocus.net

Advertisement
Conversion Technology Metas Server
Cnfocus.net is hosted in China / Beijing . Cnfocus.net doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Php, Number of used javascripts: 2. First javascripts: S_navimages.js, Date.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.8 (Win32) PHP/5.2.6.

Technologies in use by Cnfocus.net

Technology

Number of occurences: 3
  • CSS
  • Html
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • s_navimages.js
  • date.js

Server Type

  • Apache/2.2.8 (Win32) PHP/5.2.6

Powered by

  • PHP/5.2.6

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Cnfocus.net

Missing HTTPS protocol.

    Meta - Cnfocus.net

    Number of occurences: 2
    • Name:
      Content: text/html; charset=gb2312
    • Name: generator
      Content: mshtml 6.00.2900.3059

    Server / Hosting

    • IP: 114.113.158.13
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • ns2.cnolnic.net
    • ns1.cnolnic.net

    Target

    • root.cnolnic.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sat, 13 Aug 2016 08:29:08 GMT Server: Apache/2.2.8 (Win32) PHP/5.2.6 X-Powered-By: PHP/5.2.6 Set-Cookie: PHPSESSID=4f757af539e561428a24835e0dbd563a; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Content-Length: 3947 Content-Type: text/html X-Cache: MISS from s_fl343 X-Cache-Lookup: MISS from s_fl343:80 Via: 1.1 s_fl343 (squid/3.5.9) Connection: keep-alive

    DNS

    host: cnfocus.net
    1. class: IN
    2. ttl: 7200
    3. type: A
    4. ip: 114.113.158.13
    host: cnfocus.net
    1. class: IN
    2. ttl: 7200
    3. type: NS
    4. target: ns2.cnolnic.net
    host: cnfocus.net
    1. class: IN
    2. ttl: 7200
    3. type: NS
    4. target: ns1.cnolnic.net
    host: cnfocus.net
    1. class: IN
    2. ttl: 7200
    3. type: SOA
    4. mname: ns1.cnolnic.net
    5. rname: root.cnolnic.net
    6. serial: 2006112401
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 86400

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.nfocus.net, www.cdnfocus.net, www.dnfocus.net, www.crnfocus.net, www.rnfocus.net, www.ctnfocus.net, www.tnfocus.net, www.cvnfocus.net, www.vnfocus.net, www.cfnfocus.net, www.fnfocus.net, www.cgnfocus.net, www.gnfocus.net, www.chnfocus.net, www.hnfocus.net, www.cnnfocus.net, www.nnfocus.net, www.cmnfocus.net, www.mnfocus.net, www.cjnfocus.net, www.jnfocus.net, www.cfocus.net, www.cnnfocus.net, www.cnfocus.net, www.cnhfocus.net, www.chfocus.net, www.cnjfocus.net, www.cjfocus.net, www.cnkfocus.net, www.ckfocus.net, www.cnlfocus.net, www.clfocus.net, www.cn focus.net, www.c focus.net, www.cnocus.net, www.cnfqocus.net, www.cnqocus.net, www.cnfocus.net, www.cnocus.net, www.cnfaocus.net, www.cnaocus.net, www.cnfyocus.net, www.cnyocus.net, www.cnftocus.net, www.cntocus.net, www.cnfgocus.net, www.cngocus.net, www.cnfbocus.net, www.cnbocus.net, www.cnfwocus.net, www.cnwocus.net, www.cnfsocus.net, www.cnsocus.net, www.cnfdocus.net, www.cndocus.net, www.cnfrocus.net, www.cnrocus.net, www.cnf3ocus.net, www.cn3ocus.net, www.cnf4ocus.net, www.cn4ocus.net, www.cnfcus.net, www.cnfobcus.net, www.cnfbcus.net, www.cnfohcus.net, www.cnfhcus.net, www.cnfogcus.net, www.cnfgcus.net, www.cnfojcus.net, www.cnfjcus.net, www.cnfomcus.net, www.cnfmcus.net, www.cnfo cus.net, www.cnf cus.net, www.cnfovcus.net, www.cnfvcus.net, www.cnfous.net, www.cnfocdus.net, www.cnfodus.net, www.cnfocrus.net, www.cnforus.net, www.cnfoctus.net, www.cnfotus.net, www.cnfocvus.net, www.cnfovus.net, www.cnfocfus.net, www.cnfofus.net, www.cnfocgus.net, www.cnfogus.net, www.cnfochus.net, www.cnfohus.net, www.cnfocnus.net, www.cnfonus.net, www.cnfocmus.net, www.cnfomus.net, www.cnfocjus.net, www.cnfojus.net, www.cnfocs.net, www.cnfocuws.net, www.cnfocws.net, www.cnfocues.net, www.cnfoces.net, www.cnfocuss.net, www.cnfocss.net, www.cnfocuas.net, www.cnfocas.net, www.cnfocu.net, www.cnfocuse.net, www.cnfocue.net, www.cnfocusw.net, www.cnfocuw.net, www.cnfocusd.net, www.cnfocud.net, www.cnfocusx.net, www.cnfocux.net, www.cnfocusf.net, www.cnfocuf.net, www.cnfocusg.net, www.cnfocug.net, www.cnfocust.net, www.cnfocut.net,

    Other websites we recently analyzed

    1. 拉索城堡官方网站
      拉索城堡-----世界因我而不同，官方客服电话：4006-120-289。1
      Central District (Hong Kong) - 121.127.234.105
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 3
      Number of meta tags: 3
    2. iri.hs.kr
      Korea, Republic of - 211.210.30.141
      Server software:
      Technology: Javascript
    3. saltlakevalleycarpetcleaning.info
      Scottsdale (United States) - 184.168.221.42
      Server software:
      Technology: Html, Html5, Iframe
    4. Zenfolio | JL Photo & Design
      Jessica Lingenfelter Photography & Design provides graphic design work and artistic pictures and portraits with a modern and vintage flair. See our website for portfolios and pricing. Located in Neosho, MO.
      Europe - 95.100.248.121
      Server software:
      Technology: CSS, Google Font API, Html, Html5, Javascript
      Number of Javascript: 1
      Number of meta tags: 4
    5. maplelab
      Italy - 92.223.209.197
      Server software: Microsoft-IIS/7.5
      Technology: Html, Javascript, Google Analytics
      Number of meta tags: 2
    6. Дом здоровья "Оберег"
      Дом здоровья "Оберег"
      Russian Federation - 185.42.12.3
      Server software: nginx/1.0.15
      Technology: Carousel, CSS, Html, Javascript, jQuery, Php, LiveInternet counter
      Number of Javascript: 8
      Number of meta tags: 4
    7. MMM Investments
      India - 103.241.181.75
      Server software: Microsoft-IIS/8.0
      Technology: CSS, Html
    8. CSTL - Colloque santé des troupeaux laitiers
      CSTL est une organisation sans but lucratif afin de promouvoir la santé pour les troupeaux laitiers
      Saint-hyacinthe (Canada) - 24.226.183.176
      Server software: Microsoft-IIS/8.5
      Technology: CSS, Html, Javascript
      Number of meta tags: 3
    9. Telephone & Data Network - South West & London | React O Call Ltd
      We provide and install telephone systems, fibre optics and data network solutions in the South West & Greater London, call on 020 8909 5814
      United States - 93.184.220.60
      Server software: Tomahawk Ultra
      Technology: CSS, Html, Javascript, jQuery Cookie, jQuery UI, JW Player, Php, Omniture, SiteCatalyst
      Number of Javascript: 14
      Number of meta tags: 6
    10. safarischool.com.au
      Australia - 202.124.241.178
      Server software: Redirector - NetRegistry Pty Ltd
      Technology: Html
      Number of meta tags: 2

    Check Other Websites